PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 77868
Common NameSELMODRAFT_77868
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family bZIP
Protein Properties Length: 331aa    MW: 36082.7 Da    PI: 7.0176
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
77868genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.93.4e-11181239563
             CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
  bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
             kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l +l+   a l++e+
   77868 181 KRAKRILANRQSAARSKERKMRYISELERKVQTLQTEATTLSAQLTMLQRDTAGLTTEN 239
             9************************************************9999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-17177241IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.162179242IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.4E-11181236No hitNo description
SuperFamilySSF579592.11E-11181233No hitNo description
PfamPF001701.8E-9181239IPR004827Basic-leucine zipper domain
CDDcd147032.12E-23182233No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MQDVSSTPQY SPPSSSRDTN ANNNATNNSA NSGEPVRRFG HHRRAQSEIA FRLPEALSDF  60
HTNNGVNNSG GGGGGGGGGA ATNLSEMPAL SDDVGEDLLS IYIDMEKMSS PYGASNKHDS  120
GGVAALGSQQ PGHHHHARSL SMDGALQGFN ADAHDLDVES AEAKRAAAAA KLAELALVDP  180
KRAKRILANR QSAARSKERK MRYISELERK VQTLQTEATT LSAQLTMLQR DTAGLTTENN  240
ELKLRLQAME QQAQLRDALN DALKDEVQRL KIATGQISGE NGQHQLMNHQ QQQYFHHQLS  300
PQQLQQLQQL KSSPQQQQQQ QQQTDFFQCR *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002962855.10.0hypothetical protein SELMODRAFT_77868
SwissprotQ040889e-71POF21_ARATH; Probable transcription factor PosF21
TrEMBLD8QUM00.0D8QUM0_SELML; Putative uncharacterized protein
STRINGEFJ363180.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.16e-59bZIP family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]